PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A13G0749
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SBP
Protein Properties Length: 503aa    MW: 55705.4 Da    PI: 7.9152
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A13G0749genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.46.4e-41170246177
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                  +Cqv gC++dls+ k+yh+rhkvCe+hsk+++v+v+g+eqrfCqqCsrfh l efDe+krsCr+rLa+hnerrrk +
  Gh_A13G0749 170 CCQVYGCNKDLSSSKDYHKRHKVCEAHSKTAKVIVNGIEQRFCQQCSRFHLLAEFDEGKRSCRKRLAGHNERRRKIH 246
                  6*************************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.9E-34163232IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.496168245IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.77E-38169249IPR004333Transcription factor, SBP-box
PfamPF031105.9E-32171244IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 503 aa     Download sequence    Send to blast
MESWSYGSEG KGLLFTDEMD LDAFSRSRKA MLSWDLKPST DLEGVESMEF MDFGIAADMN  60
KKPFYGNTSM GIFGAEFGND STKSLVSPTC MISSTSYFGE EESGSKHCSS LMDSNSQESS  120
LIDLKLGRLT DYKDAHHGKF LKETSVVSPV RPAFVPKKAR TTSSHSQIPC CQVYGCNKDL  180
SSSKDYHKRH KVCEAHSKTA KVIVNGIEQR FCQQCSRFHL LAEFDEGKRS CRKRLAGHNE  240
RRRKIHFNTF SGKSHKLLHS YQGTKFLGTS IPKQTPFVVP NIFQVDFLHP ERHAYSNQYQ  300
QVKSEEKPMY SSQSATPITN GQSSFFHMHG SGKQHLSGTL SSATEAFNAS SAAPTVKELS  360
GVSRSDCALS LLSVQSLDLS SHVTGIQMTR PLINQAGHAN RSTEKSAAMS YSEKGSSFYS  420
CGMNPTGVSQ EGSVVVSDAG HTANFEGKVQ DLDLLSARYC LSPENGTTVD LLQLSTHLQR  480
VEQQRNSMQV KQENEDLFYF LST
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-29162244284squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.136080.0ovule
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO738612510.0
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6223300.0KJ622330.1 Gossypium hirsutum SQUAMOSA promoter binding-like transcription factor (SPL22) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012464919.10.0PREDICTED: squamosa promoter-binding-like protein 6
RefseqXP_012464920.10.0PREDICTED: squamosa promoter-binding-like protein 6
TrEMBLA0A0B0NVH10.0A0A0B0NVH1_G
STRINGPOPTR_0008s09750.11e-175(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14770918
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.15e-53SBP family protein